PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00023.1.g02210.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 568aa    MW: 62170.7 Da    PI: 10.3951
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00023.1.g02210.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.41.2e-23320363245
                           WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                    epgrCrRtDGKkWRCs+++ +++k+CErH++rgr+rsrk++e+
  Zjn_sc00023.1.g02210.1.am.mk 320 LEPGRCRRTDGKKWRCSKEAAPDSKYCERHMQRGRNRSRKPVEP 363
                                   69***************************************997 PP

2QLQ59.87.7e-21221256237
                           QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   +FT+aQ ++L++Q+l+yKyL+a++PvPpeLl++i++
  Zjn_sc00023.1.g02210.1.am.mk 221 PFTPAQYEELEQQALIYKYLLAGVPVPPELLVPIRR 256
                                   9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.4E-13220256IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.0E-14221255IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.62221256IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.021319363IPR014977WRC domain
PfamPF088792.3E-20321362IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MPPVRCRRRP VKIFVSGLAQ RARAAAREVS VAWGRAWRSL SASACAHRFP SLAPLCVLPH  60
EAVLCLKALQ SFRTSSARGK RSETTPKDGK AKNRSGTAKP KIEVERQSVW PLARRRCDHR  120
LVCPVVMNGW QKEACLLPGR HVYQLSCRPG AEHLSRLTWR RAYPSRAAPS KHRYGDALCL  180
PVSGNGSPPL LPFYRASPHS AAGEDAQRQQ QQAMSGRWPA PFTPAQYEEL EQQALIYKYL  240
LAGVPVPPEL LVPIRRGFVY HQPPRKHASP LDLVVYSDRG VQVSRLLVRA HHITSLTKLV  300
LCVRFAVGYG PPDFGKKVDL EPGRCRRTDG KKWRCSKEAA PDSKYCERHM QRGRNRSRKP  360
VEPQLVAAPI SQPPAQANLA GGCQNHTLYS AIAGSGSGAA RRGGGATGVH GLGSAAQMHM  420
DNAAPYATAA GGGSKDLRYS SYGARTLAAE QSQLISGGTD SWMENSWRLL PSQTSTFQVS  480
SYPLYGTLSG LDESTTSSLP KTERQPVSLF GSDFAMQENQ TLRPFFDEWP KSRGSWSELA  540
DDNSLSSFSA TQLSISIPMG TSTPAPDD
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5158441e-68EF515844.1 Zea mays putative growth-regulating factor 5 (GRF5) mRNA, complete cds.
GenBankEF5158451e-68EF515845.1 Zea mays putative growth-regulating factor 6 (GRF6) mRNA, complete cds.
GenBankEU9627871e-68EU962787.1 Zea mays clone 245531 growth-regulating factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976689.11e-142PREDICTED: growth-regulating factor 3-like
SwissprotQ6AWY61e-131GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLA0A0A9GJC31e-143A0A0A9GJC3_ARUDO; GRF5
STRINGSi011853m1e-138(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-36growth-regulating factor 5